PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.002G279100.1.p
Common NameSb02g031190, SORBIDRAFT_02g031190
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 265aa    MW: 29528.9 Da    PI: 8.9491
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.002G279100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.42.9e-171461148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                          +g+WT+eEd++lv ++k +G g+W++ ++  g+ R++k+c++rw +yl
  Sobic.002G279100.1.p 14 KGAWTKEEDDRLVAYIKAHGEGCWRSLPKAAGLLRCGKSCRLRWINYL 61
                          79******************************99************97 PP

2Myb_DNA-binding60.14.9e-1967111147
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                           rg++T+eEdel+++++ +lG++ W++Ia +++ gRt++++k++w+++
  Sobic.002G279100.1.p  67 RGNFTEEEDELIIKLHSLLGNK-WSLIAGRLP-GRTDNEIKNYWNTH 111
                           89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.5E-24564IPR009057Homeodomain-like
PROSITE profilePS5129416.58961IPR017930Myb domain
SuperFamilySSF466896.47E-3013108IPR009057Homeodomain-like
SMARTSM007171.9E-131363IPR001005SANT/Myb domain
PfamPF002494.9E-151461IPR001005SANT/Myb domain
CDDcd001678.05E-101661No hitNo description
PROSITE profilePS5129429.41162116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.0E-2865116IPR009057Homeodomain-like
SMARTSM007176.3E-1866114IPR001005SANT/Myb domain
PfamPF002493.3E-1767111IPR001005SANT/Myb domain
CDDcd001671.32E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010224Biological Processresponse to UV-B
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:1903086Biological Processnegative regulation of sinapate ester biosynthetic process
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 265 aa     Download sequence    Send to blast
MGRSPCCEKA HTNKGAWTKE EDDRLVAYIK AHGEGCWRSL PKAAGLLRCG KSCRLRWINY  60
LRPDLKRGNF TEEEDELIIK LHSLLGNKWS LIAGRLPGRT DNEIKNYWNT HIRRKLLSRG  120
IDPVTHRPIN EHTSNITISF EAAAAARDRE ENKGAVFRLE EHNKATAAAA AAIGRDHHQN  180
HHPAGDWGQG KPLKCPDLNL DLCISPPAAP CQEEKAMVTM KPVKREAGLC FSCSLGLPKS  240
ADCKCSNFLG LRTAMLDFRS LEMK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-291311626128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00479DAPTransfer from AT4G38620Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU2458810.0GU245881.1 Eremochloa ophiuroides P1 transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002462743.10.0hypothetical protein SORBIDRAFT_02g031190
SwissprotP200261e-143MYB1_HORVU; Myb-related protein Hv1
TrEMBLC5X6V20.0C5X6V2_SORBI; Putative uncharacterized protein Sb02g031190
STRINGSb02g031190.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP11637448
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.16e-98myb domain protein 4